PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00047.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 498aa    MW: 57140.8 Da    PI: 5.4662
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00047.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.6e-5561331128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lppGfrFhPtdeel+++yLk+k++g+++el e+i+evd+yk+ePwdLp k  + ++++ewyfFs+rd+ky++g+r+nratk gyWk
  Rsa1.0_00047.1_g00004.1   6 LPPGFRFHPTDEELITYYLKRKINGREIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDQEWYFFSPRDRKYPNGSRTNRATKGGYWK 90 
                              79****************************.99***************6345667999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd++v   +++++g+kktLv+y+grap+g +t Wvmheyrl
  Rsa1.0_00047.1_g00004.1  91 ATGKDRRVSL-RDRAIGTKKTLVYYRGRAPHGIRTGWVMHEYRL 133
                              **********.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-634157IPR003441NAC domain
PROSITE profilePS5100561.2956157IPR003441NAC domain
PfamPF023653.3E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0090602Biological Processsieve element enucleation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI TYYLKRKING REIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DQEWYFFSPR DRKYPNGSRT NRATKGGYWK ATGKDRRVSL RDRAIGTKKT LVYYRGRAPH  120
GIRTGWVMHE YRLDETECEP TAFGMQDAYA LCRVFKKIII EAKPRDQQQQ QHQPYAHTSS  180
NISRSSSFDV GSDLEISSNT HQVPPYSNAA ETQPPFGNAN TVGNHDEWLQ YLSHDMPLRF  240
SNYGSPYGPY LNPSKVYTET DCGMLQHQMS LQPLQVENSV VQTSIFSNGM NQNGGQCGFS  300
DFTFAASNPN HLYNNTVDDH LIHNGNLDEQ LLSVGNSTWM NMSNENLKQS FIEDTEILPS  360
FEENDQDLEY YGGSRTNTID NIEIDEFFSF EDRIENTDKS NITLNSSGSE MIEEEIRVDH  420
KMLVCTRQTP KVLYHQVVPS QILKIHINLI GGNEEGRLFM EEEGKDSWFQ TAENVGKMKL  480
KQIGLVAKHY YKCLTIIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D2e-54115715168NAC domain-containing protein 19
3swp_C2e-54115715168NAC domain-containing protein 19
3swp_B2e-54115715168NAC domain-containing protein 19
3swp_A2e-54115715168NAC domain-containing protein 19
3swm_D2e-54115715168NAC domain-containing protein 19
3swm_C2e-54115715168NAC domain-containing protein 19
3swm_B2e-54115715168NAC domain-containing protein 19
3swm_A2e-54115715168NAC domain-containing protein 19
4dul_B2e-54115712165NAC domain-containing protein 19
4dul_A2e-54115712165NAC domain-containing protein 19
1ut7_B2e-54115712165NO APICAL MERISTEM PROTEIN
1ut7_A2e-54115712165NO APICAL MERISTEM PROTEIN
1ut4_B2e-54115712165NO APICAL MERISTEM PROTEIN
1ut4_A2e-54115712165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610106.10.0PREDICTED: NAC domain-containing protein 86
SwissprotQ9FFI50.0NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0D3EEU30.0A0A0D3EEU3_BRAOL; Uncharacterized protein
STRINGBra006392.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44111852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.10.0NAC domain containing protein 86